PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21962.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 314aa    MW: 34195 Da    PI: 9.8106
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21962.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3970130262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +e+alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  KHN21962.1  70 PEAALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKNK 130
                 57889*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3454123IPR003851Zinc finger, Dof-type
PfamPF027016.3E-3373128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.66574128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVFSSIPVFV DPPNWQQQPN NHPQANNNGG DNTQLLPPLP PHQSHVGGSV GSIRPGSMAD  60
RARLAKLPPP EAALKCPRCD STNTKFCYFN NYSLSQPRHF CKTCRRYWTR GGALRNVPVG  120
GGCRRNKKNK RSSRSKSPAS SEKQQTLSGS TSAIVPSGGT THEQIGHQLP QPQNLPFLAS  180
LQNLNRYAVG NMGLGLREIH GQNENMGFQI GNSSAGGGMD QWRLHQQVPF FNGFESTSAG  240
SYPFQNEGIN ETPSGFGGDI TTNSRVSQMP SVKMEESGAL NLSRSTLNNV SENNQYYSWT  300
DMSGLASFSA THLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352950.0AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590988.20.0PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLA0A0B2QQI00.0A0A0B2QQI0_GLYSO; Dof zinc finger protein DOF3.6
STRINGGLYMA11G14920.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-50OBF-binding protein 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]